data_3HRN # _entry.id 3HRN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3HRN RCSB RCSB053499 WWPDB D_1000053499 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3HRO _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3HRN _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-06-09 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yu, Y.' 1 'Ulbrich, M.H.' 2 'Li, M.-H.' 3 'Buraei, Z.' 4 'Chen, X.-Z.' 5 'Ong, A.C.M.' 6 'Tong, L.' 7 'Isacoff, E.Y.' 8 'Yang, J.' 9 # _citation.id primary _citation.title 'Structural and molecular basis of the assembly of the TRPP2/PKD1 complex.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 106 _citation.page_first 11558 _citation.page_last 11563 _citation.year 2009 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19556541 _citation.pdbx_database_id_DOI 10.1073/pnas.0903684106 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yu, Y.' 1 primary 'Ulbrich, M.H.' 2 primary 'Li, M.H.' 3 primary 'Buraei, Z.' 4 primary 'Chen, X.Z.' 5 primary 'Ong, A.C.' 6 primary 'Tong, L.' 7 primary 'Isacoff, E.Y.' 8 primary 'Yang, J.' 9 # _cell.length_a 43.642 _cell.length_b 43.642 _cell.length_c 200.351 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 3HRN _cell.pdbx_unique_axis ? _cell.Z_PDB 18 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'H 3 2' _symmetry.entry_id 3HRN _symmetry.Int_Tables_number 155 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transient receptor potential (TRP) channel subfamily P member 2 (TRPP2)' 7352.629 1 ? ? 'C-terminal of Coiled Coil Domain, UNP residues 833-895' ? 2 water nat water 18.015 110 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Polycystin-2, Polycystic kidney disease 2 protein, Autosomal dominant polycystic kidney disease type II protein, Polycystwin, R48321 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLG _entity_poly.pdbx_seq_one_letter_code_can MGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 VAL n 1 4 SER n 1 5 TYR n 1 6 GLU n 1 7 GLU n 1 8 PHE n 1 9 GLN n 1 10 VAL n 1 11 LEU n 1 12 VAL n 1 13 ARG n 1 14 ARG n 1 15 VAL n 1 16 ASP n 1 17 ARG n 1 18 MET n 1 19 GLU n 1 20 HIS n 1 21 SER n 1 22 ILE n 1 23 GLY n 1 24 SER n 1 25 ILE n 1 26 VAL n 1 27 SER n 1 28 LYS n 1 29 ILE n 1 30 ASP n 1 31 ALA n 1 32 VAL n 1 33 ILE n 1 34 VAL n 1 35 LYS n 1 36 LEU n 1 37 GLU n 1 38 ILE n 1 39 MET n 1 40 GLU n 1 41 ARG n 1 42 ALA n 1 43 LYS n 1 44 LEU n 1 45 LYS n 1 46 ARG n 1 47 ARG n 1 48 GLU n 1 49 VAL n 1 50 LEU n 1 51 GLY n 1 52 ARG n 1 53 LEU n 1 54 LEU n 1 55 ASP n 1 56 GLY n 1 57 VAL n 1 58 ALA n 1 59 GLU n 1 60 ASP n 1 61 GLU n 1 62 ARG n 1 63 LEU n 1 64 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PKD2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta 2(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pCDFDuet-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PKD2_HUMAN _struct_ref.pdbx_db_accession Q13563 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLG _struct_ref.pdbx_align_begin 833 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3HRN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13563 _struct_ref_seq.db_align_beg 833 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 895 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 833 _struct_ref_seq.pdbx_auth_seq_align_end 895 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3HRN _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q13563 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'EXPRESSION TAG' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3HRN _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 50.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details 'Dioxane, NaAc, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2006-06-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 3HRN _reflns.d_resolution_high 1.900 _reflns.d_resolution_low 30.000 _reflns.number_obs 6163 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_netI_over_sigmaI 36.178 _reflns.pdbx_chi_squared 1.329 _reflns.pdbx_redundancy 10.700 _reflns.percent_possible_obs 100.000 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.number_all 6163 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.97 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.287 _reflns_shell.meanI_over_sigI_obs 9.93 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 1.173 _reflns_shell.pdbx_redundancy 10.60 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 585 _reflns_shell.percent_possible_all 100.00 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3HRN _refine.ls_d_res_high 1.900 _refine.ls_d_res_low 30.000 _refine.pdbx_ls_sigma_F 2 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 95.600 _refine.ls_number_reflns_obs 5883 _refine.ls_number_reflns_all 6101 _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all 0.222 _refine.ls_R_factor_obs 0.205 _refine.ls_R_factor_R_work 0.199 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.260 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 10.100 _refine.ls_number_reflns_R_free 624 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 28.006 _refine.solvent_model_param_bsol 54.761 _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 5.421 _refine.aniso_B[2][2] 5.421 _refine.aniso_B[3][3] -10.842 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 'PDB ENTRY 1ZIJ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.839 _refine.B_iso_max 79.05 _refine.B_iso_min 5.61 _refine.occupancy_max 1.00 _refine.occupancy_min 0.50 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 553 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 110 _refine_hist.number_atoms_total 663 _refine_hist.d_res_high 1.900 _refine_hist.d_res_low 30.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.013 ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? 1.299 ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param CNS_TOPPAR:dna-rna.top 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param CNS_TOPPAR:water.top 'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param CNS_TOPPAR:ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 3HRN _struct.title ;crystal structure of a C-terminal coiled coil domain of Transient receptor potential (TRP) channel subfamily P member 2 (TRPP2, polycystic kidney disease 2) ; _struct.pdbx_descriptor Polycystin-2 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3HRN _struct_keywords.text ;coiled coil, helix bundle, trimer, Calcium, Disease mutation, Glycoprotein, Ion transport, Ionic channel, Membrane, Phosphoprotein, Polymorphism, Transmembrane, Transport, TRANSPORT PROTEIN ; _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 4 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 64 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 835 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 895 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 61 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 3HRN _atom_sites.fract_transf_matrix[1][1] 0.022914 _atom_sites.fract_transf_matrix[1][2] 0.013229 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026458 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004991 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 833 833 GLY GLY A . n A 1 3 VAL 3 834 834 VAL VAL A . n A 1 4 SER 4 835 835 SER SER A . n A 1 5 TYR 5 836 836 TYR TYR A . n A 1 6 GLU 6 837 837 GLU GLU A . n A 1 7 GLU 7 838 838 GLU GLU A . n A 1 8 PHE 8 839 839 PHE PHE A . n A 1 9 GLN 9 840 840 GLN GLN A . n A 1 10 VAL 10 841 841 VAL VAL A . n A 1 11 LEU 11 842 842 LEU LEU A . n A 1 12 VAL 12 843 843 VAL VAL A . n A 1 13 ARG 13 844 844 ARG ARG A . n A 1 14 ARG 14 845 845 ARG ARG A . n A 1 15 VAL 15 846 846 VAL VAL A . n A 1 16 ASP 16 847 847 ASP ASP A . n A 1 17 ARG 17 848 848 ARG ARG A . n A 1 18 MET 18 849 849 MET MET A . n A 1 19 GLU 19 850 850 GLU GLU A . n A 1 20 HIS 20 851 851 HIS HIS A . n A 1 21 SER 21 852 852 SER SER A . n A 1 22 ILE 22 853 853 ILE ILE A . n A 1 23 GLY 23 854 854 GLY GLY A . n A 1 24 SER 24 855 855 SER SER A . n A 1 25 ILE 25 856 856 ILE ILE A . n A 1 26 VAL 26 857 857 VAL VAL A . n A 1 27 SER 27 858 858 SER SER A . n A 1 28 LYS 28 859 859 LYS LYS A . n A 1 29 ILE 29 860 860 ILE ILE A . n A 1 30 ASP 30 861 861 ASP ASP A . n A 1 31 ALA 31 862 862 ALA ALA A . n A 1 32 VAL 32 863 863 VAL VAL A . n A 1 33 ILE 33 864 864 ILE ILE A . n A 1 34 VAL 34 865 865 VAL VAL A . n A 1 35 LYS 35 866 866 LYS LYS A . n A 1 36 LEU 36 867 867 LEU LEU A . n A 1 37 GLU 37 868 868 GLU GLU A . n A 1 38 ILE 38 869 869 ILE ILE A . n A 1 39 MET 39 870 870 MET MET A . n A 1 40 GLU 40 871 871 GLU GLU A . n A 1 41 ARG 41 872 872 ARG ARG A . n A 1 42 ALA 42 873 873 ALA ALA A . n A 1 43 LYS 43 874 874 LYS LYS A . n A 1 44 LEU 44 875 875 LEU LEU A . n A 1 45 LYS 45 876 876 LYS LYS A . n A 1 46 ARG 46 877 877 ARG ARG A . n A 1 47 ARG 47 878 878 ARG ARG A . n A 1 48 GLU 48 879 879 GLU GLU A . n A 1 49 VAL 49 880 880 VAL VAL A . n A 1 50 LEU 50 881 881 LEU LEU A . n A 1 51 GLY 51 882 882 GLY GLY A . n A 1 52 ARG 52 883 883 ARG ARG A . n A 1 53 LEU 53 884 884 LEU LEU A . n A 1 54 LEU 54 885 885 LEU LEU A . n A 1 55 ASP 55 886 886 ASP ASP A . n A 1 56 GLY 56 887 887 GLY GLY A . n A 1 57 VAL 57 888 888 VAL VAL A . n A 1 58 ALA 58 889 889 ALA ALA A . n A 1 59 GLU 59 890 890 GLU GLU A . n A 1 60 ASP 60 891 891 ASP ASP A . n A 1 61 GLU 61 892 892 GLU GLU A . n A 1 62 ARG 62 893 893 ARG ARG A . n A 1 63 LEU 63 894 894 LEU LEU A . n A 1 64 GLY 64 895 895 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1 1 HOH WAT A . B 2 HOH 2 2 2 HOH WAT A . B 2 HOH 3 3 3 HOH WAT A . B 2 HOH 4 4 4 HOH WAT A . B 2 HOH 5 5 5 HOH WAT A . B 2 HOH 6 6 6 HOH WAT A . B 2 HOH 7 7 7 HOH WAT A . B 2 HOH 8 8 8 HOH WAT A . B 2 HOH 9 9 9 HOH WAT A . B 2 HOH 10 10 10 HOH WAT A . B 2 HOH 11 11 11 HOH WAT A . B 2 HOH 12 12 12 HOH WAT A . B 2 HOH 13 13 13 HOH WAT A . B 2 HOH 14 14 14 HOH WAT A . B 2 HOH 15 15 15 HOH WAT A . B 2 HOH 16 16 16 HOH WAT A . B 2 HOH 17 17 17 HOH WAT A . B 2 HOH 18 18 18 HOH WAT A . B 2 HOH 19 19 19 HOH WAT A . B 2 HOH 20 20 20 HOH WAT A . B 2 HOH 21 21 21 HOH WAT A . B 2 HOH 22 22 22 HOH WAT A . B 2 HOH 23 23 23 HOH WAT A . B 2 HOH 24 24 24 HOH WAT A . B 2 HOH 25 25 25 HOH WAT A . B 2 HOH 26 26 26 HOH WAT A . B 2 HOH 27 27 27 HOH WAT A . B 2 HOH 28 28 28 HOH WAT A . B 2 HOH 29 29 29 HOH WAT A . B 2 HOH 30 30 30 HOH WAT A . B 2 HOH 31 31 31 HOH WAT A . B 2 HOH 32 32 32 HOH WAT A . B 2 HOH 33 33 33 HOH WAT A . B 2 HOH 34 34 34 HOH WAT A . B 2 HOH 35 35 35 HOH WAT A . B 2 HOH 36 36 36 HOH WAT A . B 2 HOH 37 37 37 HOH WAT A . B 2 HOH 38 38 38 HOH WAT A . B 2 HOH 39 39 39 HOH WAT A . B 2 HOH 40 40 40 HOH WAT A . B 2 HOH 41 41 41 HOH WAT A . B 2 HOH 42 42 42 HOH WAT A . B 2 HOH 43 43 43 HOH WAT A . B 2 HOH 44 44 44 HOH WAT A . B 2 HOH 45 45 45 HOH WAT A . B 2 HOH 46 46 46 HOH WAT A . B 2 HOH 47 47 47 HOH WAT A . B 2 HOH 48 48 48 HOH WAT A . B 2 HOH 49 49 49 HOH WAT A . B 2 HOH 50 50 50 HOH WAT A . B 2 HOH 51 51 51 HOH WAT A . B 2 HOH 52 52 52 HOH WAT A . B 2 HOH 53 53 53 HOH WAT A . B 2 HOH 54 54 54 HOH WAT A . B 2 HOH 55 55 55 HOH WAT A . B 2 HOH 56 56 56 HOH WAT A . B 2 HOH 57 57 57 HOH WAT A . B 2 HOH 58 58 58 HOH WAT A . B 2 HOH 59 59 59 HOH WAT A . B 2 HOH 60 60 60 HOH WAT A . B 2 HOH 61 61 61 HOH WAT A . B 2 HOH 62 62 62 HOH WAT A . B 2 HOH 63 63 63 HOH WAT A . B 2 HOH 64 64 64 HOH WAT A . B 2 HOH 65 65 65 HOH WAT A . B 2 HOH 66 66 66 HOH WAT A . B 2 HOH 67 67 67 HOH WAT A . B 2 HOH 68 68 68 HOH WAT A . B 2 HOH 69 69 69 HOH WAT A . B 2 HOH 70 70 70 HOH WAT A . B 2 HOH 71 71 71 HOH WAT A . B 2 HOH 72 72 72 HOH WAT A . B 2 HOH 73 73 73 HOH WAT A . B 2 HOH 74 74 74 HOH WAT A . B 2 HOH 75 75 75 HOH WAT A . B 2 HOH 76 76 76 HOH WAT A . B 2 HOH 77 77 77 HOH WAT A . B 2 HOH 78 78 78 HOH WAT A . B 2 HOH 79 79 79 HOH WAT A . B 2 HOH 80 80 80 HOH WAT A . B 2 HOH 81 81 81 HOH WAT A . B 2 HOH 82 82 82 HOH WAT A . B 2 HOH 83 83 83 HOH WAT A . B 2 HOH 84 84 84 HOH WAT A . B 2 HOH 85 85 85 HOH WAT A . B 2 HOH 86 86 86 HOH WAT A . B 2 HOH 87 87 87 HOH WAT A . B 2 HOH 88 88 88 HOH WAT A . B 2 HOH 89 89 89 HOH WAT A . B 2 HOH 90 90 90 HOH WAT A . B 2 HOH 91 91 91 HOH WAT A . B 2 HOH 92 92 92 HOH WAT A . B 2 HOH 93 93 93 HOH WAT A . B 2 HOH 94 94 94 HOH WAT A . B 2 HOH 95 95 95 HOH WAT A . B 2 HOH 96 96 96 HOH WAT A . B 2 HOH 97 97 97 HOH WAT A . B 2 HOH 98 98 98 HOH WAT A . B 2 HOH 99 99 99 HOH WAT A . B 2 HOH 100 100 100 HOH WAT A . B 2 HOH 101 101 101 HOH WAT A . B 2 HOH 102 102 102 HOH WAT A . B 2 HOH 103 103 103 HOH WAT A . B 2 HOH 104 104 104 HOH WAT A . B 2 HOH 105 105 105 HOH WAT A . B 2 HOH 106 106 106 HOH WAT A . B 2 HOH 107 107 107 HOH WAT A . B 2 HOH 108 108 108 HOH WAT A . B 2 HOH 109 109 109 HOH WAT A . B 2 HOH 110 110 110 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4780 ? 1 MORE -46 ? 1 'SSA (A^2)' 13360 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 21.8210000000 0.8660254038 -0.5000000000 0.0000000000 37.7950806720 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -21.8210000000 -0.8660254038 -0.5000000000 0.0000000000 37.7950806720 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-07-28 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 PHASER . ? program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 4 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns-online.org/ Fortran_77 ? 5 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 StructureStudio . ? ? ? ? 'data collection' ? ? ? # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 0 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #